PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 297aa    MW: 33395.8 Da    PI: 9.0406
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G ++W+++++  g+ R++k+c++rw +yl
       AA26G00004 13 RGLWSPEEDEKLLRYITTHGHPSWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding54.82.2e-1766109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++ +eE+++++da++ lG++ W+ Ia++++ gRt++++k++w++
       AA26G00004  66 RGSFNAEEEQIIIDAHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 109
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-25563IPR009057Homeodomain-like
PROSITE profilePS5129417.653860IPR017930Myb domain
SuperFamilySSF466896.36E-2911107IPR009057Homeodomain-like
SMARTSM007171.1E-121262IPR001005SANT/Myb domain
PfamPF002491.4E-151360IPR001005SANT/Myb domain
CDDcd001673.41E-111660No hitNo description
PROSITE profilePS5129426.51961115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2564115IPR009057Homeodomain-like
SMARTSM007173.6E-1665113IPR001005SANT/Myb domain
PfamPF002492.3E-1566109IPR001005SANT/Myb domain
CDDcd001672.61E-1268108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGHRCCGKHK VKRGLWSPEE DEKLLRYITT HGHPSWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGSFN AEEEQIIIDA HRILGNKWAQ IAKHLPGRTD NEVKNFWNSC IKKKLLSQGL  120
DPTTHNLMPS RRRSSSNNHN LHHTKLKPGN KASESGTAFS ITNVNPHSST KPNPNPNPNR  180
PSSLIPLKYS PNPTLLSQPM LINVPYNPTI NDAMSGLVDT ENVGNCSAWS EVDGMLLSTH  240
TPQIHSELSQ KEQSIRGHHM DILFDTPSTS FDPDIASIFS SAMSVDFNPM DDLEWPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884922.11e-129hypothetical protein ARALYDRAFT_897482
TrEMBLD7L0J71e-129D7L0J7_ARALL; Putative uncharacterized protein
STRINGscaffold_301452.11e-129(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-119myb domain protein 67